Share this post on:

Product: 73-311ACTL6B antibody
Quantity: 5 ml
Synonyms: 53 kDa BRG1-associated factor B, ACTL6, Actin-like protein 6B, Actin-related protein Baf53b, ArpNalpha, BAF53B
Presentation: Supernatant
Clonality: Monoclonal
Host: Mouse
Isotype: IgG1
CAS NO: 54-80-8 Product: Pronethalol
Shipping to: Worldwide
Immunogen: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (also known as 53 kDa BRG1-associated factor B, BRG1-associated factor 53B, Actin-like protein 6B, ArpNalph
Application: Immunoblot (IB)Immunohistochemistry (IHC)Immunocytochemistry (ICC)
Background:
Concentration:
Storage:
Buffer System:
Preservatives:
State: Supernatant
Specifictiy: Does not cross-react with BAF53a

Share this post on:

Author: Cholesterol Absorption Inhibitors