Share this post on:

Product: 75-296ABCC9 / SUR2 (Isoform SUR2A) antibody
Quantity: 0.1 ml
Synonyms: ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2
Presentation: Purified
Clonality: Monoclonal
Host: Mouse
Isotype: IgG2a
CAS NO: 851546-61-7 Product: PSI-697
Shipping to: Worldwide
Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A, accession number P70170).
Application: Immunoblot (IB)Immunohistochemistry (IHC)Immunocytochemistry (ICC)
Background:
Concentration:
Storage:
Buffer System:
Preservatives:
State: Purified
Specifictiy: Does not cross-react with SUR2B

Share this post on:

Author: Cholesterol Absorption Inhibitors