Product: AM50264PU-SANO1 / DOG1 antibody
Quantity: 0.1 mg
Synonyms: Anoctamin-1, DOG-1, Discovered on gastrointestinal stromal tumors protein 1, ORAOV2, Oral cancer overexpressed protein 2, TAOS2, TMEM16A, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2
Presentation: Purified
Clonality: Monoclonal
Host: Mouse
Isotype: IgG1
CAS NO: 1196800-40-4 Product: Omadacycline (mesylate)
Shipping to: Worldwide
Immunogen: Recombinant Human DOG-1 protein (DG1/447) and a synthetic peptide from Human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).GeneID:55107
Application: Flow Cytometry: 0.5-1 μg/million cells.Immunofluorescence: 0.5-1 μg/ml.Western Blotting: 0.5-1 μg/ml.Immunoprecipitation: 0.5-1 μg/500 μg protein lysate.Immunohistochemistry on Frozen and Formalin-fixed Sections: 0.5-1.0 μg/ml for 30 minutes at RT.Stainin
Background: DOG1 gene, a gastrointestinal stromal tumor (GIST) specific gene, encoding for the hypothetical protein FLJ10261, which was named Discovered on GIST 1 (DOG1). DOG1 protein is expressed ubiquitously in gastrointestinal stromal tumors irrespective of KIT or
Concentration: 0.2 mg/ml
Storage: Store undiluted at 2-8°C.Shelf life: one year from despatch.
Buffer System: 10mM PBS
Preservatives: 0.05% Sodium Azide
State: Liquid purified IgG fraction from Bioreactor ConcentratePurified
Specifictiy: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagno