Name :
Recombinant Human CD48
Specification :
| Description : BLAST1 is the designation used for an activation-associated cell surface glycoprotein of 40 to 45 kD expressed primarily in mitogen-stimulated human lymphocytes. The protein sequence predicted by the cDNA encoding BLAST1 indicates that BLAST1 is a member of the immunoglobulin supergene family. Yokoyama (1991) identified the BLAST1 activation/adhesion molecule as CD48. | Protein length : 169 amino acids | Molecular Weight : 44.330kDa inclusive of tags | Source : Wheat germ | Form : Liquid | Purity : Proprietary Purification | Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | Sequences of amino acids : MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSN VTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESK FKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQE WKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGE EERKTSGQV | Sequence Similarities : Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Information :
| Gene Name : CD48 CD48 molecule [ Homo sapiens ] | Official Symbol : CD48 | Synonyms : CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein) , CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2; | Gene ID : 962 | mRNA Refseq : NM_001778 | Protein Refseq : NP_001769 | MIM : 109530 | Uniprot ID : P09326 | Chromosome Location : 1q21.3-q22 | Pathway : Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem; | Function : antigen binding; eukaryotic cell surface binding; protein binding; receptor activity;
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GM-CSF Protein
IGF-I/IGF-1 Protein
Popular categories:
IL-1R1/CD121a
LIR-6