Name :
Recombinant Human CD69
Specification :
| Description : This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. | Protein length : 110 amino acids | Molecular Weight : 37.730kDa inclusive of tags | Source : Wheat germ | Tissue specificity : Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets. | Form : Liquid | Purity : Proprietary Purification | Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | Sequences of amino acids : VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDM NFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTG SDKCVFLKNTEVSSMECEKNLYWICNKPYK | Sequence Similarities : Contains 1 C-type lectin domain.
Gene Information :
| Gene Name : CD69 CD69 molecule [ Homo sapiens ] | Official Symbol : CD69 | Synonyms : CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; | Gene ID : 969 | mRNA Refseq : NM_001781 | Protein Refseq : NP_001772 | MIM : 107273 | Uniprot ID : Q07108 | Chromosome Location : 12p13 | Function : binding; sugar binding; transmembrane signaling receptor activity;
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SCF Protein
Nectin-2/CD112 Protein
Popular categories:
Insulin-like Growth Factor 1 Receptor
CD133
