Name :
Recombinant Human CD7
Specification :
| Description : This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. | Protein length : 220 amino acids | Molecular Weight : 50.310kDa inclusive of tags | Source : Wheat germ | Form : Liquid | Purity : Proprietary Purification | Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione | Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | Sequences of amino acids : PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT MHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWH RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACV VYEDMSHSRCNTLSSPNQYQ | Sequence Similarities : Contains 1 Ig-like (immunoglobulin-like) domain.
Gene Information :
| Gene Name : CD7 CD7 molecule [ Homo sapiens ] | Official Symbol : CD7 | Synonyms : CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41; | Gene ID : 924 | mRNA Refseq : NM_006137 | Protein Refseq : NP_006128 | MIM : 186820 | Uniprot ID : P09564 | Chromosome Location : 17q25.2-q25.3 | Pathway : Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; | Function : receptor activity;
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
EIF5A Protein
NEDD8 Protein
Popular categories:
Pattern Recognition Receptors
P-Cadherin/Cadherin-3
