Recombinant Human CD80, Fc-tagged

Specification :
| Description : The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy. | Conjugation : Fc | Tissue specificity : Expressed on activated B-cells, macrophages and dendritic cells. | Form : Liquid | Purity : Protein A purified | Storage buffer : Preservative: NoneConstituents: PBS, pH 7.2 | Storage : Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. | Sequences of amino acids : MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTK EVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGD MNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRI ICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAV SSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP DDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGKExtracel lular domain (amino acids 1-241) of human B7.1 sequence is underlined.Human Fc sequence is in italics. | Sequence Similarities : Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.