Recombinant Human CEACAM8

Specification :
| Description : Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) also known as CD66b (Cluster of Differentiation 66b), is a human gene. | Protein length : 349 amino acids | Molecular Weight : 64.390kDa inclusive of tags | Source : Wheat germ | Tissue specificity : Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow. | Form : Liquid | Purity : Proprietary Purification | Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | Sequences of amino acids : MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEA VPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRII GYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSY TLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDK DAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTL TLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAP TISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQY TQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD ALVQGSSPGLSARATVSIMIGVLARVALI | Sequence Similarities : Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain.