Share this post on:

Name :
Recombinant Human CLEC4M, FC-tagged

Specification :
| Description : This gene encodes a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants. | Conjugation : Fc | Tissue specificity : Predominantly highly expressed in liver sinusoidal endothelial cells and in lymph node. Found in placental endothelium but not in macrophages. Expressed in type II alveolar cells and lung endothelial cells. | Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec | Purity : >95% by SDS-PAGE | Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin | Storage : Store at +4°C. | Sequences of amino acids : Theoretical sequence:HGTELPSPPSKLQVSKVPSSLSQEQ SEQD AIYQNLTQLKAAVGELSEKSKLQEI YQELTQLKAAVGE LPEKSKLQEIYQELTRLKAAVGELP EKSKLQEIYQELT RLKAAVGELPEKSKLQEIYQELTRL KAAVGELP EKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAV GEL PDQSKQQQIYQELTDLKTAFERLCR HCPKDWTFFQGNC YFMSNSQRNWHDSVTACQEVRAQLV VIKTAEEQNFLQL QTSRSNRFSWMGLSDLNQEGTWQWV DGSPLSPSFQRYW NSGEPNNSGNEDCAEFSGSGWNDNR CDVDNYWICKKPAACFRDGIPKVDK KVEPKSCDKTHTCPPCPAPELLGGP SVF LFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGK EYKCRVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHE ALH NHYTQKSLSLSPGK | Sequence Similarities : Contains 1 C-type lectin domain. | Gene ID : CLEC4M C-type lectin domain family 4, member M [ Homo sapiens ] | Official Symbol : CLEC4M | Synonyms : CLEC4M; C-type lectin domain family 4, member M; CD209L, CD299, CD299 antigen; C-type lectin domain family 4 member M; DC SIGN2; DC SIGNR; DCSIGNR; HP10347; LSIGN;

Gene Information :
| Gene ID : CLEC4M C-type lectin domain family 4, member M [ Homo sapiens ] | Official Symbol : CLEC4M | Synonyms : CLEC4M; C-type lectin domain family 4, member M; CD209L, CD299, CD299 antigen; C-type lectin domain family 4 member M; DC SIGN2; DC SIGNR; DCSIGNR; HP10347; LSIGN;

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CG alpha Protein
Protein L Protein
Popular categories:
CD27 Ligand
Interferon-Stimulated Gene 15 (ISG15)

Share this post on:

Author: Cholesterol Absorption Inhibitors