Recombinant Human CD97

Specification :
| Description : This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19. | Protein length : 109 amino acids | Molecular Weight : 37.620kDa inclusive of tags | Source : Wheat germ | Tissue specificity : Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastric, esophageal and p | Form : Liquid | Purity : Proprietary Purification | Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | Sequences of amino acids : KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNS PILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLCAFWKS DSDRGGHWATEGCQVLGSKNGSTTCQCSH | Sequence Similarities : Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.Contains 5 EGF-like domains.Contains 1 GPS domain.