Recombinant Human CEACAM3 Protein, His-SUMO-tagged | Cholesterol Absorption Inhibitors cholesterol-absorption.com

Name :
Recombinant Human CEACAM3 Protein, His-SUMO-tagged

Specification :
| Source : E. coli | Species : Human | Tag : His-SUMO | Form : Tris-based buffer, 50% glycerol. | Molecular Mass : 29.1 kDa | AA Sequence : KLTIESMPLSVAEGKEVLLLVHNLP QHLFGYSWYKGERVDGNSLIVGYVI GTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDL VNEEATGQFHVYQENAPGLPVGAVA G | Purity : Greater than 90% as determined by SDS-PAGE. | Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information :
| Gene Name : CEACAM3 carcinoembryonic antigen-related cell adhesion molecule 3 [ Homo sapiens ] | Official Symbol : CEACAM3 | Synonyms : CEACAM3; carcinoembryonic antigen-related cell adhesion molecule 3; CD66d antigen; OTTHUMP00000196409; carcinoembryonic antigen CGM1; carcinoembryonic antigen gene family member 1; nonspecific cross-reacting antigen; CEA; CGM1; W264; W282; CD66D; MGC119875 | Gene ID : 1084 | mRNA Refseq : NM_001815 | Protein Refseq : NP_001806 | MIM : 609142 | UniProt ID : P40198

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
AMIGO2 Protein
IL-12R beta 1 Protein
Popular categories:
G Protein-Coupled Receptor Class C Group 5 Member D (GPRC5D)
ALK-2/ACVR1

Author: Cholesterol Absorption Inhibitors

Related Posts