Recombinant Human CEACAM6

Specification :
| Description : Carcinoembryonic antigen (CEA; MIM 114890) is one of the most widely used tumor markers in serum immunoassay determinations of carcinoma. An apparent lack of absolute cancer specificity for CEA probably results in part from the presence in normal and neoplastic tissues of antigens that share antigenic determinants with the 180-kD form of CEA (Barnett et al. | Protein length : 110 amino acids | Molecular Weight : 37.730kDa inclusive of tags | Source : Wheat germ | Form : Liquid | Purity : Proprietary Purification | Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | Sequences of amino acids : PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSN GNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLY GPDVPTISPSKANYRPGENLNLSCHAASNP | Sequence Similarities : Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain.