Recombinant Human CXCR2 protein, His-SUMO-tagged

Specification :
| Source : E. coli | Species : Human | Tag : His-SUMO | Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | Molecular Mass : 20.6 kDa | Protein length : 1-40aa | AA Sequence : MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE | Purity : Greater than 90% as determined by SDS-PAGE. | Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.