Share this post on:

Name :
Recombinant Human CXCR3 protein, His-GST-tagged

Specification :
| Source : E. coli | Species : Human | Tag : His-GST | Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | Molecular Mass : 36.6 kDa | Protein length : 4-50aa | AA Sequence : EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN | Purity : Greater than 85% as determined by SDS-PAGE. | Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information :
| Gene Name : CXCR3 chemokine (C-X-C motif) receptor 3 [ Homo sapiens ] | Official Symbol : CXCR3 | Synonyms : CXCR3; chemokine (C-X-C motif) receptor 3; G protein coupled receptor 9 , GPR9; C-X-C chemokine receptor type 3; CD183; CKR L2; CMKAR3; IP10 R; MigR; CXC-R3; CXCR-3; Mig receptor; IP10 receptor; IP-10 receptor; G protein-coupled receptor 9; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; GPR9; CD182; Mig-R; CKR-L2; IP10-R; | Gene ID : 2833 | mRNA Refseq : NM_001142797 | Protein Refseq : NP_001136269 | MIM : 300574 | UniProt ID : P49682

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HLA-A*0201 P53 R175H Complex Tetramer Protein
OPRD1 Protein
Popular categories:
Checkpoint Kinase 1 (Chk1)
Siglec-1

Share this post on:

Author: Cholesterol Absorption Inhibitors