Name :
Recombinant Human CXCR6 protein, GST-tagged
Specification :
| Source : E. coli | Species : Human | Tag : GST | Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | Protein length : Met1-Val32 | AA Sequence : MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKV | Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. | Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder. | Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Information :
| Gene Name : CXCR6 chemokine (C-X-C motif) receptor 6 [ Homo sapiens ] | Official Symbol : CXCR6 | Synonyms : CXCR6; chemokine (C-X-C motif) receptor 6; C-X-C chemokine receptor type 6; BONZO; CD186; STRL33; TYMSTR; CDw186; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; | Gene ID : 10663 | mRNA Refseq : NM_006564 | Protein Refseq : NP_006555 | MIM : 605163 | UniProt ID : O00574
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PD-L1 Protein
SP-D Protein
Popular categories:
B7-H3
Complement Component 4 Binding Protein Alpha
