Name :
Recombinant Human DICER1, His-tagged
Specification :
| Description : This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Alternative splicing results in multiple transcript variants. | Conjugation : HIS | Source : E. coli | Form : Lyophilised:Reconstitute with 141 μl aqua dest. | Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | Sequences of amino acids : LLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCP TRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLK IPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKA YLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKH LYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFK AVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEE KEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYY PMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERT YDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRS LKANQPQVPNS | Sequence Similarities : Belongs to the helicase family. Dicer subfamily.Contains 1 Dicer dsRNA-binding fold domain.Contains 1 DRBM (double-stranded RNA-binding) domain.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 1 PAZ domain.Contains 2 R
Gene Information :
| Gene Name : DICER1 dicer 1, ribonuclease type III [ Homo sapiens ] | Official Symbol : DICER1 | Synonyms : DICER1; dicer 1, ribonuclease type III; Dicer1, Dcr 1 homolog (Drosophila); endoribonuclease Dicer; Dicer; dicer 1; double stranded RNA specific endoribonuclease; HERNA; K12H4.8 LIKE; KIAA0928; | Gene ID : 23405 | mRNA Refseq : NM_001195573 | Protein Refseq : NP_001182502 | MIM : 606241 | Uniprot ID : Q9UPY3 | Chromosome Location : 14q32.2 | Pathway : MicroRNA (miRNA) Biogenesis, organism-specific biosystem; Regulatory RNA pathways, organism-specific biosystem; mRNA processing, organism-specific biosystem; | Function : ATP binding; ATP-dependent helicase activity; double-stranded RNA binding; endonuclease activity; helicase activity;
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OGN/Osteoglycin Proteinsite
Lanosterol synthase/LSSFormulation
Popular categories:
IL-10 Receptor
ENPP-7