Name :
Recombinant Human ENTPD1
Specification :
| Description : Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) also known as CD39 (Cluster of Differentiation 39), is a human gene. | Protein length : 510 amino acids | Molecular Weight : 82.170kDa inclusive of tags | Source : Wheat germ | Tissue specificity : Expressed primarily on activated lymphoid cells. Also expressed in endothelial tissues. The vascular isoform and the placental isoform II are present in both placenta and umbilical vein, whereas placental isoform I is present in placenta only. | Form : Liquid | Purity : Proprietary Purification | Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | Sequences of amino acids : MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQN KALPENVKYGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQ VEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQ HQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYP FDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVP YETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFR LYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRD PCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIG NYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAF SAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTS YAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFI GKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFL MVLFSLVLFTVAIIGLLIFHKPSYFWKDMV | Sequence Similarities : Belongs to the GDA1/CD39 NTPase family.
Gene Information :
| Gene Name : ENTPD1 ectonucleoside triphosphate diphosphohydrolase 1 [ Homo sapiens ] | Official Symbol : ENTPD1 | Synonyms : ENTPD1; ectonucleoside triphosphate diphosphohydrolase 1; CD39; ATPDase; NTPDase 1; | Gene ID : 953 | mRNA Refseq : NM_001098175 | Protein Refseq : NP_001091645 | MIM : 601752 | Uniprot ID : P49961 | Chromosome Location : 10q23.1-q24.1 | Pathway : Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem; | Function : ATP binding; hydrolase activity; nucleoside-diphosphatase activity; nucleoside-triphosphatase activity; nucleotide binding;
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ALOX12 Proteincustom synthesis
Serpin E2 Proteinmanufacturer
Popular categories:
IGF-I R/CD221
Dengue Virus Proteins
