Recombinant Human F11 Receptor, His-tagged

Specification :
| Cat. No. : F11R-6785H | Description : F11R, also known asCD321, belongs to the immunoglobulin superfamily. It seems to plays a role inepithelial tight junction formation. Tight junctions represent one mode ofcell-to-cell adhesion in epithelial or endothelial cell sheets, formingcontinuous seals around cells and serving as a physical barrier to preventsolutes and water from passing freely through the paracellular space. F11Rprotein can act as (1) a receptor for reovirus, (2) a ligand for the IntegrinLFA1, involved in leukocyte transmigration, and (3) a platelet receptor | Form : Liquid. 20mMTris-HCl buffer (pH8.0) containing 10% glycerol 0.15M NaCl,1mM DTT | Molecular Weight : 25.8kDa (238aa),confirmed by MALDI-TOF | Purity : > 90% by SDS -PAGE | Concentration : 1 mg/ml (determinedby BCA assay) | Sequences of aminoacids : MGSSHHHHHHSSGLVPRGSH MGSHMLGSVT VHSSEPEVRI PENNPVKLSC AYSGFSSPRV EWKFDQGDTT RLVCYNNKITASYEDRVTFLPTGITFKSVT REDTGTYTCM VSEEGGNSYG EVKVKLIVLV PPSKPTVNIP SSATIGNRAVLTCSEQDGSP PSEYTWFKDG IVMPTNPKSTRAFSNSSYVL NPTTGELVFD PLSASDTGEY SCEARNGYGTPMTSNAVRME AVERNVGV | Storage : Can be stored at+4°C short term (1-2 weeks). For long term storage, aliquot and store at-20°C or -70°C. Avoid repeated freezing and thawing cycles. | Pathways : Cell adhesion molecules (CAMs);Epithelial cell signaling in Helicobacter pylori infection; Leukocytetransendothelial migration; Tight junction; Cell-cell adhesion systems;Hemostasis; Integrin cell surface interactions; Signaling in Immune system