Recombinant Human FCGR2B protein, Myc/DDK-tagged

Specification :
| Description : The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. | Source : HEK293T | Species : Human | Tag : Myc/DDK | Form : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. | Molecular Mass : 33.8 kDa | AA Sequence : myc-FLAG tag | Product-Related Proteins : TA50011-100 LC400365 TA349972 C204496 | Purity : > 80% | Usage : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | Storage : Store at -80 centigrade. | Concentration : >50 ug/mL