Share this post on:

Product: 73-399ABCC9 / SUR2 (Isoform SUR2B) antibody
Quantity: 5 ml
Synonyms: ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2
Presentation: Supernatant
Clonality: Monoclonal
Host: Mouse
Isotype: IgG2a
CAS NO: 409345-29-5 Product: JNJ16259685
Shipping to: Worldwide
Immunogen: Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B (also known as Sulfonylurea receptor 2B, ATPbinding cassette transporter sub-family C member 9B and Abcc9B, accession number Q63563-2).
Application: Immunoblot (IB).Immunocytochemistry (ICC). Immunohistochemistry (IHC).
Background:
Concentration:
Storage:
Buffer System:
Preservatives:
State: Supernatant
Specifictiy: Does not cross-react with SUR1

Share this post on:

Author: Cholesterol Absorption Inhibitors