Product: AM20463PU-NApolipoprotein A II / Apo AII antibody
Quantity: 50 µg
Synonyms: APOA2, Apo-AII, ApoA-II, Apolipoprotein A-II, Apolipoprotein A2
Presentation: Purified
Clonality: Monoclonal
Host: Mouse
Isotype: IgG1
CAS NO: 371935-79-4 Product: PI-103 (Hydrochloride)
Shipping to: Worldwide
Immunogen: APOA2 (AAH05282, 1 a.a. ~ 101 a.a) full length recombinant protein with GST tag.AA Sequence:MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLI KKAGTELVNFLSYFVELGTQPATQ*GeneID:336Remarks:MW of the GST tag alone is 26 KDa.
Application: ELISA.Sandwich ELISA (Recombinant protein).Western blot (Transfected lysate): Use transfected 293T cell as Positive Control.Immunohistochemistry on Paraffin Sections: 5 µg/ml.
Background:
Concentration:
Storage: Store the antibody (in aliquots) at -20°C.Avoid repeated freezing and thawing.Shelf life: one year from despatch.
Buffer System: PBS, pH 7.2
Preservatives:
State: Liquid purified IgG fractionPurified
Specifictiy: Recognizes Apolipoprotein AII (APOA2)
