Product: TA329016Aquaporin-4 / AQP4 antibody
Quantity: 0.2 ml
Synonyms: AQP-4, MIWC, Mercurial-insensitive water channel, WCH4
Presentation: Purified
Clonality: Polyclonal
Host: Rabbit
Isotype:
CAS NO: 50-07-7 Product: Mitomycin C
Shipping to: Europe, USA/Canada
Immunogen: GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSK AAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGK DSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4. Intracellular, C-terminus.GeneID:25293
Application: WB: 1:200-1:2000; IHC: 1:100-1:3000; FC: 1:50-1:600;
Background: Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12). The aquaporins can be divided into two functiol groups based
Concentration:
Storage:
Buffer System: Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Preservatives:
State: Purified
Specifictiy:
